GLP-1(7-36), Amide Acetate | CAS 1119517-19-9 (Acetate) / 89750-14-1 (Sequence) | Native GLP-1 Receptor Agonist (Research Use Only) | Knowlux

Product Description

GLP-1(7-36), Amide Acetate is the acetate salt of glucagon-like peptide-1 (7-36), amide, human, supplied by Knowlux for laboratory research use. It is the principal postprandial circulating form of endogenous GLP-1 and a high-affinity agonist of the GLP-1 receptor. The product is intended for research, laboratory, or industrial intermediate use only.

CAS Distinction: Three registry numbers are associated with GLP-1(7-36) and must be distinguished by molecular form. CAS 89750-14-1 is the broad registry entry for the GLP-1(7-36) sequence, corresponding to the free-base formula C149H226N40O45 and molecular weight approximately 3297.62. CAS 107444-51-9 identifies the C-terminally amidated net peptide. CAS 1119517-19-9 is assigned specifically to the acetate salt, the form supplied under this listing, with a molecular weight of 3357.73. The Certificate of Analysis for this product references 1119517-19-9.

Product Identification

Sequence Information

One-Letter Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Three-Letter Sequence: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

GLP-1(7-36)amide arises from sequential post-translational processing of proglucagon in intestinal L-cells: full-length GLP-1(1-37/1-36) undergoes N-terminal truncation to remove residues 1-6, yielding GLP-1(7-37) or GLP-1(7-36), followed by C-terminal amidation. The amidation eliminates the terminal negative charge, confers resistance to exopeptidase attack, and defines the predominant circulating active incretin in humans, accounting for approximately 75% of postprandial GLP-1 bioactivity.

Physicochemical Properties

Reconstitution Guidance: The acetate salt achieves substantially higher aqueous solubility than the trifluoroacetate (TFA) form. For a 100 mg/mL stock, brief ultrasonication is required; without sonication, dissolution may be incomplete. Prepare single-use aliquots after reconstitution and avoid repeated freeze-thaw cycles.

Quality Specifications

Specification Context: The purity figure of >= 98% (HPLC) is the prevailing research-grade benchmark for this peptide across major suppliers; the 99.37% batch value cited above represents a representative high-purity lot. Peptide content (>= 80% by nitrogen determination) is a distinct metric from HPLC purity and should be evaluated independently when calculating molar quantities for assay work.

Biological Activity

GLP-1(7-36)amide acetate is the principal postprandial circulating form of endogenous GLP-1 and a high-affinity agonist of the GLP-1 receptor (GLP-1R), a class B G protein-coupled receptor. Its established pharmacological actions include:

• Glucose-dependent insulin secretion: Stimulates insulin release from pancreatic beta-cells under hyperglycemic conditions, with the insulinotropic effect diminishing as glucose concentrations normalize.

• Glucagon suppression: Inhibits alpha-cell glucagon secretion, reducing hepatic glucose output.

• Delayed gastric emptying and satiety: Slows gastric transit and promotes central and peripheral satiety signaling, reducing caloric intake.

• Beta-cell tropism: Preclinical evidence supports promotion of beta-cell proliferation and survival with concomitant inhibition of apoptosis.

In vitro studies consistently demonstrate that GLP-1(7-36)amide secretion from enteroendocrine cells is dose-dependently stimulated by glucose and unsaturated fatty acids (oleic, linoleic, and linolenic acids), and that the peptide retains full bioactivity in standardized cell-based assay systems.

Applications

• Incretin biology and metabolic research: Reference agonist for GLP-1R signaling, insulin secretion, beta-cell function, and energy-balance investigations.

• Drug discovery assay standard: Active comparator and pharmacological benchmark in GLP-1 receptor agonist development programs, including cAMP accumulation, receptor binding, and downstream signaling assays.

• Analytical method development: Calibration standard and quality control material for ELISA and LC-MS/MS methods targeting GLP-1(7-36)amide.

• Peptide formulation science: Model peptide for investigating DPP-4 degradation kinetics, fibrillation propensity, and long-acting modification strategies such as fatty-acid acylation and albumin binding.

Storage and Stability

Reconstituted Solution Guidance: GLP-1(7-36)amide is a natural substrate of dipeptidyl peptidase-4 (DPP-4) and undergoes rapid N-terminal degradation in biological matrices. For cell-based or enzymatic assays requiring sustained activity, include a DPP-4 inhibitor in the buffer or limit handling time at ambient temperature. At neutral pH and elevated concentrations, the peptide exhibits a propensity for amyloid-like fibril formation; concentrated stocks should be prepared cautiously and diluted promptly into assay medium.

Regulatory and Use Restriction

This product is supplied for research, laboratory, or industrial intermediate use only. It is not intended for human or veterinary diagnostic, therapeutic, or cosmetic use and must not be administered to humans. The buyer is responsible for compliance with all applicable local regulations governing the handling and use of peptide research materials.

Supplier Note

Knowlux supplies GLP-1(7-36) amide acetate as part of a broader portfolio spanning peptide research materials, veterinary raw materials, and fine chemicals. Batch-specific documentation, including Certificate of Analysis, mass spectrometry data, and HPLC traces, is available upon request. Purchasers should verify the batch COA against the specifications listed above for the intended application.

Verification Summary

Compliance Statement

FOR RESEARCH USE ONLY. NOT FOR HUMAN USE. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

This product is supplied for laboratory research use only. It is not for human or animal administration, not for diagnostic or therapeutic use, not for retail sale, and not for personal use. The purchaser is responsible for verifying product specifications against their specific research requirements and for compliance with all applicable institutional, local, and national regulations governing research chemical acquisition, storage, and use. No web links or hyperlinks are included in this document.