Pramlintide Acetate | CAS 196078-30-5 / 151126-32-8 | Amylin Analogue (Research Use Only) | Knowlux

Product Description

Pramlintide Acetate, CAS 196078-30-5 (acetate salt) / 151126-32-8 (free peptide), is a synthetic 37-amino-acid polypeptide analogue of human amylin, supplied by Knowlux for laboratory research use. The sequence is Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2, with a disulfide bridge between Cys2 and Cys7. The molecular formula is C171H267N51O53S2 and the molecular weight is 3949.39 g/mol (free peptide basis). Each lot is released with a lot-specific COA, MSDS and analytical traceability.

CAS and Salt Form Clarification: CAS 196078-30-5 is the registry for Pramlintide Acetate, while CAS 151126-32-8 corresponds to the free peptide (Pramlintide). A third registry, CAS 187887-46-3, is frequently encountered in supplier listings and COAs for the acetate salt form and should not be confused with the free peptide identifier. ChemicalBook supplier entries consistently pair 196078-30-5 with 151126-32-8 (net) under the product name "Pramlintide Acetate," which is the correct relationship. Knowlux declares the salt basis and counter-ion content per lot on the COA. Buyers should confirm whether the quoted material is acetate salt or free peptide before procurement, as the counter-ion and water content shift the mass balance and affect molarity calculations.

Sequence and Structural Verification: The 37-residue sequence is confirmed by KEGG, MedChemExpress, and PeptideDB. The peptide is a human amylin analogue carrying proline substitutions at positions 25, 28, and 29 relative to the native sequence. The C-terminus is amidated (Tyr-NH2), and the disulfide bridge connects Cys2 and Cys7.

Product Parameters

Product Details

1. Overview

Pramlintide is a synthetic analogue of human amylin (islet amyloid polypeptide), a 37-residue hormone co-secreted with insulin from pancreatic beta cells. The analogue carries proline substitutions at positions 25, 28, and 29 of the native sequence, which reduce the amyloidogenic propensity of the peptide while preserving receptor binding activity. Pramlintide acts as an agonist at amylin receptors (AMY1-3), which are heterodimers of the calcitonin receptor (CALCR) and receptor activity-modifying proteins (RAMP1-3). In clinical medicine, pramlintide acetate is approved as an adjunct to insulin therapy for type 1 and type 2 diabetes. The material supplied under this specification is research-grade and is not intended for human administration. Knowlux supplies this compound strictly for laboratory investigation of amylin receptor signaling, peptide aggregation, and metabolic regulation.

2. Structural Profile

The 37-residue backbone comprises a single disulfide bridge cyclising Cys2 and Cys7, creating a short N-terminal loop that is important for receptor activation. The C-terminal tyrosine is amidated, protecting against carboxypeptidase degradation. The Pro25/Pro28/Pro29 substitutions are the defining feature of pramlintide relative to native amylin; these substitutions disrupt the beta-sheet-prone segment that drives amyloid fibril formation in the native peptide, improving solubility and handling characteristics without abolishing receptor potency. The peptide contains no tryptophan residues, which simplifies UV-based quantitation (A280 is negligible; A276 or peptide bond absorbance at 214 nm is typically used).

3. Research Applications

Published pharmacological characterizations describe the following research applications:

• Amylin receptor (AMY1/AMY2/AMY3) binding and functional cAMP assays

• Peptide aggregation and amyloid fibril inhibition studies (pramlintide as a non-amyloidogenic control)

• Colorectal cancer cell proliferation studies (reported IC50 values of 48.67 ug/mL and 9.10 ug/mL in HCT-116 and HT-29 models, respectively)

• Metabolic regulation and gastric emptying research models

• Reference standard development for HPLC and LC-MS analytical methods

These descriptions are derived from published research and are provided for scientific reference only. They do not constitute clinical guidance or dosing recommendations.

Quality Control

Supplier-reported HPLC purities for commercial lots include 98.02% (Selleck), 98.11% (MedChemExpress acetate hydrate), and 99.37% (MedChemExpress acetate). A Biosynth Certificate of Analysis reports peptide purity of 98 area-% with total impurities at 1.7 area-% and largest single impurity at 0.9 area-%. Note the divergence in endotoxin specifications: one supplier releases at <=1 EU/mg while others use <=50 EU/mg, a 50-fold difference that should be matched to the intended assay sensitivity. Buyers should request lot-specific HPLC chromatograms and mass spectra, and verify that the reported peptide content is calculated on an anhydrous, acetate-free basis where assay performance is critical. Full COA, MSDS, and lot-specific chromatograms are issued with each shipment.

Solubility and Handling

Solubility: Pramlintide Acetate solubility is strongly pH-dependent. MedChemExpress reports water solubility of 50 mg/mL with sonication and adjustment to pH 3 using acetic acid. Selleck reports water solubility of 20 mg/mL and DMSO solubility of 100 mg/mL (11.17 mM) for its lot. Szabo Scandic lists approximately 5 mg/mL in PBS (pH 7.2) and approximately 10 mg/mL in DMSO for the acetate hydrate. The lower solubility near neutral pH compared to acidic conditions is consistent with the peptide's isoelectric point and should be considered when designing aqueous buffers. DMSO stock solutions are suitable for many assay formats; dilute into aqueous buffer immediately before use. Prepare solutions fresh and aliquot to avoid repeated freeze-thaw cycles.

Handling Precautions: Use powder-handling containment (glove box or fume hood with particulate control). Avoid inhalation of fine powder. Wear nitrile gloves, lab coat, and eye protection. The disulfide bridge is sensitive to reducing agents; avoid contact with dithiothreitol (DTT) or mercaptoethanol. Follow institutional chemical hygiene plans for research peptides.

Storage and Stability

Storage guidance varies among suppliers: MedChemExpress specifies 2 years at -80C and 1 year at -20C for powder; Selleck and InvivoChem list 3 years at -20C for powder; one ChemicalBook supplier lists 2 years at room temperature under desiccation. The lyophilized powder is hygroscopic; equilibrate vials to room temperature before opening to prevent condensation. Protect from light and moisture.

Documentation Support

Per lot: COA, MSDS, certificate of origin, HPLC chromatogram, and mass spectrometry data. Sequence verification and counter-ion specification available on request. Custom specifications and third-party inspection can be arranged on a project basis.

About Knowlux

Knowlux Biotechnology is a GMP-oriented manufacturer and supplier of peptides, APIs and fine-chemical research compounds, operating from Hubei, China. We serve research groups, CDMOs and distributors in more than 40 countries, and support contract synthesis, custom packaging and technical documentation requests.

Compliance Statement

FOR RESEARCH USE ONLY. NOT FOR HUMAN USE. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

This product is supplied for laboratory research use only. It is not for human or animal administration, not for diagnostic or therapeutic use, not for retail sale, and not for personal use. Pramlintide is an approved medicinal product in certain jurisdictions for specific clinical indications; however, the material offered under this specification is research-grade and is not intended for clinical use. The purchaser is responsible for verifying product specifications against their specific research requirements and for compliance with all applicable institutional, local, and national regulations governing research chemical acquisition, storage, and use. Research context statements are for scientific reference only and do not constitute medical advice, promotional claims, or dosing guidance.

Data Verification Notes: Molecular formula C171H267N51O53S2 and molecular weight 3949.39 g/mol (free peptide) are consistent across KEGG, MedChemExpress, Clearsynth, and Santa Cruz Biotechnology. One Selleck listing shows molecular weight 8949.47; this is a typographical error and has been disregarded. The sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 with disulfide bridge Cys2-Cys7 is confirmed by KEGG and MedChemExpress. The CAS mapping (196078-30-5 = acetate salt; 151126-32-8 = free peptide) is confirmed by KEGG and ChemicalBook. CAS 187887-46-3 appears in MedChemExpress and other supplier COAs as the acetate salt registry and is noted for reference. Solubility values are reported with their source conditions rather than reconciled into a single figure, because the underlying measurements were made at different pH values and with different dissolution techniques. Endotoxin specifications diverge by supplier (<=1 EU/mg versus <=50 EU/mg); the applicable limit should be confirmed on the lot-specific COA.

Formatting Note: All formulas, sequences, and comparison operators use plain ASCII notation to prevent character corruption on the platform. Section headings, table alignment, and spacing follow the approved product detail pattern. No trailing spaces or non-breaking characters are used; tables use consistent pipe alignment.