Aviptadil | CAS 40077-57-4 | Vasoactive Intestinal Peptide Analogue (Research Use Only) | Knowlux

Product Description

Aviptadil, CAS 40077-57-4, is a synthetic 28-amino-acid peptide corresponding to the human vasoactive intestinal peptide (VIP) sequence, supplied by Knowlux for laboratory research use. The sequence is His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2. The molecular formula is C147H238N44O42S and the molecular weight is 3325.80 g/mol (free peptide basis). Each lot is released with a lot-specific COA, MSDS and analytical traceability.

CAS and Salt Form Clarification: CAS 40077-57-4 is the registry for the Aviptadil free peptide. The acetate salt form is assigned CAS 1444827-29-5, with molecular formula C147H238N44O42S.C2H4O2 and molecular weight approximately 3385.9 g/mol. Supplier listings on ChemicalBook and Molnova frequently use 40077-57-4 under the product name "Aviptadil Acetate," conflating the free peptide and salt registries. Knowlux declares the salt basis and counter-ion content per lot on the COA. Buyers should confirm whether the quoted material is free peptide or acetate salt before procurement, as the counter-ion shifts the mass balance by approximately 60 g/mol and affects molarity calculations in assay design.

Sequence Verification Note: The 28-residue sequence is confirmed by KEGG, MedChemExpress, and AdipoGen. The C-terminus is amidated (Asn-NH2). Aviptadil is identical in sequence to native human VIP and is sometimes referred to by the research code RLF-100.

Product Parameters

Product Details

1. Overview

Aviptadil is a synthetic form of vasoactive intestinal peptide (VIP), a 28-residue neuropeptide belonging to the secretin-glucagon-CRF superfamily. It binds with high affinity to the class II G protein-coupled receptors VPAC1 and VPAC2, activating adenylyl cyclase and elevating intracellular cAMP. In research settings, Aviptadil is used to study VIP-mediated vasodilation, pulmonary vascular biology, smooth muscle proliferation, and neuroimmune regulation. While Aviptadil has been investigated in clinical trials for pulmonary arterial hypertension and SARS-CoV-2-related respiratory failure, the material supplied under this specification is research-grade and is not intended for human administration. Knowlux supplies this compound strictly for laboratory investigation.

2. Structural Profile

The linear 28-residue backbone carries a free N-terminal histidine and an amidated C-terminal asparagine. The sequence contains a methionine residue at position 17 (Met17), which introduces a thioether side chain susceptible to oxidation to methionine sulfoxide during storage and handling. The peptide also contains multiple basic residues (Arg12, Arg14, Lys15, Lys20, Lys21) and acidic residues (Asp3, Asp8, Asp11), giving it a mixed charge profile at physiological pH. Unlike disulfide-constrained peptides such as Linaclotide or Eptifibatide, Aviptadil is flexible and linear, which has implications for both receptor binding kinetics and analytical characterization.

3. Receptor Pharmacology and Research Applications

VIP and Aviptadil activate VPAC1 and VPAC2 with comparable potency in recombinant receptor assays, with reported EC50 values of approximately 3 nM (VPAC1) and 8 nM (VPAC2) for cAMP accumulation. Binding to VPAC1 on pulmonary alveolar type II cells and other targets has been studied in the context of lung injury and inflammation. Published research applications include:

• VPAC1/VPAC2 receptor binding and cAMP functional assays

• Pulmonary vasodilation and vascular smooth muscle proliferation studies

• Neuroimmune and anti-inflammatory signaling research

• Peptide stability and methionine oxidation studies

These descriptions are derived from published research and are provided for scientific reference only. They do not constitute clinical guidance or dosing recommendations.

Quality Control

Solubility and Handling

Solubility: Aviptadil solubility is highly dependent on salt form, buffer composition, and supplier-specific measurement conditions. Reported values for the free peptide and acetate salt span a wide range: AdipoGen lists 1 mg/mL in water or 1% acetic acid; GlpBio and ChemicalBook list 1 mg/mL in water; Molnova reports >=65 mg/mL in water; MedChemExpress lists 100 mg/mL in water with sonication for the free peptide, and 100 mg/mL in water (with sonication) and 50 mg/mL in DMSO for the acetate salt; AbMole reports 33.33 mg/mL in water. These divergences likely reflect differences in salt form, residual counter-ion content, and whether sonication was applied. For assay development, solubility should be empirically determined on the specific lot and buffer system rather than assumed from a single catalog value. Prepare solutions fresh and aliquot to avoid repeated freeze-thaw cycles.

Handling Precautions: Use powder-handling containment (glove box or fume hood with particulate control). Avoid inhalation of fine powder. Wear nitrile gloves, lab coat, and eye protection. The methionine thioether is susceptible to oxidation; handle under inert atmosphere where practical and avoid prolonged exposure to air and light.

Storage and Stability

Storage guidance varies among suppliers: MedChemExpress specifies 2 years at -80C and 1 year at -20C for powder, while AbMole lists 3 years at -20C and 2 years at 4C for powder. Adooq states that the lyophilized form is stable for 36 months at -20C. The lyophilized powder is hygroscopic; equilibrate vials to room temperature before opening to prevent condensation. Protect from light and moisture.

Documentation Support

Per lot: COA, MSDS, certificate of origin, HPLC chromatogram, and mass spectrometry data. Sequence verification and counter-ion specification available on request. Orthogonal impurity profiling (e.g., CE-MS) can be arranged on a project basis for applications requiring deeper impurity characterization.

About Knowlux

Knowlux Biotechnology is a GMP-oriented manufacturer and supplier of peptides, APIs and fine-chemical research compounds, operating from Hubei, China. We serve research groups, CDMOs and distributors in more than 40 countries, and support contract synthesis, custom packaging and technical documentation requests.

Compliance Statement

FOR RESEARCH USE ONLY. NOT FOR HUMAN USE. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

This product is supplied for laboratory research use only. It is not for human or animal administration, not for diagnostic or therapeutic use, not for retail sale, and not for personal use. Aviptadil has been investigated in clinical trials but is not approved as a medicinal product in any jurisdiction for the indications described in this document; the material offered under this specification is research-grade and is not intended for clinical use. The purchaser is responsible for verifying product specifications against their specific research requirements and for compliance with all applicable institutional, local, and national regulations governing research chemical acquisition, storage, and use. Research context statements are for scientific reference only and do not constitute medical advice, promotional claims, or dosing guidance.

Data Verification Notes: The molecular formula C147H238N44O42S and molecular weight 3325.80 g/mol for the free peptide are confirmed across KEGG, MedChemExpress, and AdipoGen. The sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 is consistent across KEGG, MedChemExpress, AdipoGen, and ChemicalBook. The acetate salt CAS 1444827-29-5 and approximate molecular weight 3385.9 g/mol are confirmed by Biorbyt, Adooq, and MedChemExpress; listings that apply CAS 40077-57-4 to the acetate salt form are technically imprecise. Solubility values are not reconciled into a single figure because the source measurements were made under different conditions and on different salt forms; the range is reported as-is with the underlying conditions noted. The VPAC1/VPAC2 EC50 values (3 nM and 8 nM) are from a comparative pharmacology source and are provided for reference. The CE-MS impurity study (PubMed PMID 24176753) is cited to support the recommendation for orthogonal analytical methods rather than a single HPLC purity figure.

Formatting Note: All formulas, sequences, and comparison operators use plain ASCII notation to prevent character corruption on the platform. Section headings, table alignment, and spacing follow the approved product detail pattern. No trailing spaces or non-breaking characters are used; tables use consistent pipe alignment.