Dulaglutide (LY2189265) | CAS 923950-08-7 | GLP-1 Receptor Agonist | Knowlux

Product Description

Dulaglutide, CAS 923950-08-7, is a recombinant long-acting GLP-1 receptor agonist supplied by Knowlux at ≥98% HPLC purity. It is a ~59.7 kDa homodimeric Fc-fusion protein expressed in CHO cells, with each GLP-1 (7-37) analogue linked to a modified human IgG4 Fc domain. Each lot is released with a lot-specific COA, MSDS and full analytical traceability.

Product Parameters

Item	Specification
Product Name	Dulaglutide
CAS No.	923950-08-7
Molecular Formula	C2646H4044N704O836S18
Molecular Weight	59,671 Da (≈59.7 kDa)
Structural Class	Homodimer of two identical disulfide-linked chains, 29,841 Da each
Chain Composition	GLP-1 (7-37) analogue – peptide linker – modified human IgG4 Fc
GLP-1 Moiety Sequence	HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
Expression System	Recombinant CHO cell line
Appearance	White to off-white lyophilized powder
Purity	≥98.0% (SEC-HPLC, monomer); ≥98.0% (RP-HPLC)
Identity	LC-MS molecular weight and peptide mapping
Grade	Research grade; GMP grade on request
Endotoxin	≤5 EU/mg
Host Cell Protein	≤100 ppm (ELISA)
Host Cell DNA	≤10 ng/mg (qPCR)
Moisture	≤5.0% (Karl Fischer)
Storage	2–8 °C, sealed, protected from light; long-term ≤ ?20 °C
Shelf Life	24 months under recommended storage
HS Code	2937.19.00
Packaging	1 mg / 5 mg / 10 mg / 100 mg / 1 g vial; bulk and OEM on request
MOQ	10 mg (research grade); 1 g (bulk)
Supply Ability	Gram to kilogram scale
Application	Pharmaceutical R&D and manufacturing
Origin	China

Product Details

1. Overview

Dulaglutide (LY2189265, Trulicity) is a once-weekly GLP-1 receptor agonist. The GLP-1 analogue provides receptor agonism; the IgG4 Fc domain extends half-life to ~4.5–5 days by slowing absorption and reducing renal clearance. It is resistant to DPP-4 degradation relative to native GLP-1.

2. Mechanism of Action

Dulaglutide binds GLP-1 receptor on pancreatic β-cells and activates Gs-coupled cAMP signalling, producing glucose-dependent insulin secretion, glucagon suppression, slowed gastric emptying and reduced appetite.

3. Quality Control

Test Item	Method
Purity / monomer	SEC-HPLC
Purity / related impurities	RP-HPLC
Identity & molecular mass	LC-MS (deconvoluted)
Primary structure	Peptide mapping / amino acid analysis
Aggregation & fragments	SEC-MALS (on request)
Glycosylation profile	SDS-PAGE / IEF (on request)
Endotoxin	LAL (kinetic turbidimetric)
Host cell protein / DNA	ELISA / qPCR
Moisture / appearance	Karl Fischer / visual
Sterility & bioburden	Membrane filtration (GMP grade)

4. Applications

• Reference standard and impurity/aggregate studies for GLP-1 receptor agonist methods

• GLP-1R binding, cAMP and β-cell functional assay development

• Formulation development for long-acting injectable peptides and Fc-fusion proteins

• Biosimilarity and analog research, including glycoform and aggregation profiling

• LC-MS, immunoassay and bioassay calibrators

5. Packaging, Storage & Shipping

Borosilicate glass vial with butyl stopper and aluminium seal, under inert gas where required; tamper-evident, light-protected carton with desiccant. Cold-chain 2–8 °C with validated gel packs and temperature logger; dry ice for ?20 °C shipments. COA, MSDS, packing list and certificate of origin issued with each shipment.

6. Documentation Support

Per lot: COA, MSDS, certificate of origin, GMO/allergen-free statement, residual solvent and elemental impurity statements, stability data summaries. Regulatory packages (DMF/CEP references, site information, audit support) available on a project basis.

Compliance Statement

This product is supplied for pharmaceutical research, development and manufacturing use by licensed organisations only. It is not for direct human or veterinary administration, not for retail sale, and not for personal use. Mechanism and clinical development statements are for scientific reference only and do not constitute medical advice, promotional claims, or dosing guidance.

About Knowlux

Knowlux Biotechnology is a GMP-oriented manufacturer and supplier of peptides, APIs and fine-chemical research compounds, operating from Hubei, China. We serve research groups, CDMOs and distributors in more than 40 countries, and support contract synthesis, custom packaging and technical documentation requests.